HORDB

ID: hor002922
Uniprot ID: Q25461
Protein name: RPGW-amide
Gene name: NA
Organism: Mytilus edulis (Blue mussel)
Family: NA
Source: animal
Expression: Expressed in cerebral, pedal and visceral ganglia. TPGW-amide is found in pedal and cerebral ganglia and in shell adductor muscle (at protein level). RPGW-amide and KPGW-amide are found in pedal retractor muscle, ABRM and shell adductor muscle (at protein
Disease: NA
Comments: NA
Taxonomy: Mytilus (genus), Mytilinae (subfamily), Mytilidae (family), Mytiloidea (superfamily), Mytilida (order), Pteriomorphia, Autobranchia (subclass), Bivalvia (class), Mollusca (phylum), Lophotrochozoa, Spiralia, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: NA
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: NA

Sequence: RPGW
Length: 4(51-54)
Propeptide: METLNIFLVIFSLLGTIIIASSSDESSERKKRDLDTIDDTNNDFLTADKRRPGWGKRSFDDDILNNLDKRRPGWGKRSDMLFDSEEIEKRRPGWGKRSSSLYDDEKRKPGWGKRSSALLDDLSLYNSIVKRRPGWGKRSDTFKVDIRRPGWGKRTPGWGKRSGPNMCMDFQDEILQLYKLLNEAEKLHSECEALNI
Signal peptide: METLNIFLVIFSLLGTIIIASS
Modification: T4 Tryptophan amide
Glycosylation: NA
Mutagenesis: NA

Function: Be involved in control of muscle contraction and may function as neurotransmitters; increase tension of the pedal retractor muscle and, in conjunction with FMRF-amide, increase peak tension of the anterior byssus retractor muscle (ABRM)
Mechanism: Tetrapeptides may be further processed to GW-amide, which is found in cerebral and pedal ganglia, by a dipeptidyl aminopeptidase.
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor002922_AF2.pdb

hor002922_ESM.pdb

Mass:	56827	Formula:	C24H34N8O5
Absent amino acids:	ACDEFHIKLMNQSTVY	Common amino acids:	GPRW
pI:	10.55	Basic residues:	1
Polar residues:	1	Hydrophobic residues:	1
Hydrophobicity:	-185	Boman Index:	-1165
Half-Life:	1 hour	Half-Life Yeast:	2 min
Half-Life E.Coli:	2 min	Aliphatic Index	0
Instability Index:	8650	Extinction Coefficient cystines:	5500
Absorbance 280nm:	1833.33

PubMed ID: 10799681
Title: HPLC and electrospray ionization mass spectrometry as tools for the identification of APGWamide-related peptides in gastropod and bivalve mollusks: comparative activities on Mytilus muscles.